utec-auto: Keyword Search
| Domain | Age yrs |
Ahrefs DR |
Moz DA |
Maj CF |
Maj TF |
Maj Dom |
Expiring InExp |
|
|---|---|---|---|---|---|---|---|---|
| fibrana.co | - | 02m | ||||||
| belladain.co | - | 02m | ||||||
| familylawspecialistslimerick.ie | - | 03m | ||||||
| brispack.com.au | - | 03m | ||||||
| streetstance.co | - | 03m | ||||||
| carestaf.co | - | 03m | ||||||
| trendserve.au | - | 04m | ||||||
| whosshout.com.au | - | 04m | ||||||
| trendserve.com.au | - | 04m | ||||||
| buyroo.au | - | 04m |
The DomCop support team is the best I've ever found, fast and friendly and always available to add new features to give us customers the best experience! The price and impressive service make me feel at home with DomCop. If you try the free trial you will never go away
Paolo MauronerItaly
